1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 | using System;
using System.Collections.Generic;
using System.ComponentModel;
using System.Data;
using System.Drawing;
using System.Linq;
using System.Text;
using System.Threading.Tasks;
using System.Windows.Forms;
namespace PWMjack
{
public partial class Form1 : Form
{
public Form1()
{
InitializeComponent();
}
private void Go_Click(object sender, EventArgs e)
{
wavetime.Interval = Int32.Parse(avlue.Text);
wavetime.Enabled = true;
}
private void wavetime_Tick(object sender, EventArgs e)
{
Console.Beep();
wavetime.Interval = Int32.Parse(avlue.Text);
}
private void avlue_TextChanged(object sender, EventArgs e)
{
}
private void track_Scroll(object sender, EventArgs e)
{
avlue.Text = track.Value.ToString();
wavetime.Interval= Int32.Parse(avlue.Text);
}
}
}
|
Saturday, September 5, 2015
Audio Jack PWM
Needed a goodway to do pwm from the computer directly, went with the audio jack as the source. Pretty simple script and GUI but this damn bog is just a showcase in case for some reason I need to demonstrate whatever.
Friday, September 4, 2015
Phishbot: The Message: Part III
Okay, it is pretty easy from here. All we need to do now is inject some .NET into our solution to solve the issue of cross window communication( rather not edit all the JS right?).
My dorm neighbors are arguing over whether cardio or lifting makes you "more smarter"....
THe Cleverbot:
you can also get this straight from the C# but I don't give a flying.
Facebook is pretty simple we can measure where the mouse needs to be to click in the box and then we just type like a human with the .append() feature of C# or inject JS to do the same thing by installing a value into an active JS variable.
In C# (Mixing up the languages) we can write:
That ought to do it, I might fill in the details later for y'all but there is really no need. Happy fishing!
My dorm neighbors are arguing over whether cardio or lifting makes you "more smarter"....
THe Cleverbot:
Facebook is pretty simple we can measure where the mouse needs to be to click in the box and then we just type like a human with the .append() feature of C# or inject JS to do the same thing by installing a value into an active JS variable.
In C# (Mixing up the languages) we can write:
Coupled with a form like this:
which prints the current position of our cursor each time we press enter. Also for those Java fans out there:
MouseInfo.getPointerInfo().getLocation
and print it into a Jtextbox.
Now we simply need a form:
which navigates to the target and enters torrents of data to enter. The mouse can be maneuvered to the appropriate position like so:
for C# or:
for Java.
That ought to do it, I might fill in the details later for y'all but there is really no need. Happy fishing!
Thursday, September 3, 2015
PhishBot: The Message: Part II
McCormack here, signing in from a new IP. After being shipped off to college I have decided that in order to stay sane I will be working on many projects here as the "teachs" haven't yet given out busy work. Anyway from where we left off.
So we need a way to have JS message between two different windows, that way we can link a system like Cleverbot up to our Facebook Messaging Service for our Phishbot. There is such a way localStorage which ought to work here. Now we could run the whole system through Post and Pull requests but for right now we will wait and C(haha).
To pull data from cleverbot is easy, we can identify the span or just hijack the share button for our nefarious purposes directly:
Okay, lets try hijacking first:
We need to get to this snipBox:
That is just a button click away or two, we just need to confirm that the button names are not dynamic like they are on fb, else we will have to switch our methodology as I demonstrated how to bypass dynamic web code in a previous post.
Trying directly from the console:
Success is undefined in a non philosophical way here because there isn't an ouput but that sure did open the first dialogue:
Finishing:
Okay and now we parse that data, but I have to go take a Spanish placement exam, so I'd rather make a new post after than continue this one.
Chao
So we need a way to have JS message between two different windows, that way we can link a system like Cleverbot up to our Facebook Messaging Service for our Phishbot. There is such a way localStorage which ought to work here. Now we could run the whole system through Post and Pull requests but for right now we will wait and C(haha).
To pull data from cleverbot is easy, we can identify the span or just hijack the share button for our nefarious purposes directly:
Okay, lets try hijacking first:
We need to get to this snipBox:
That is just a button click away or two, we just need to confirm that the button names are not dynamic like they are on fb, else we will have to switch our methodology as I demonstrated how to bypass dynamic web code in a previous post.
Trying directly from the console:
Success is undefined in a non philosophical way here because there isn't an ouput but that sure did open the first dialogue:
Finishing:
Okay and now we parse that data, but I have to go take a Spanish placement exam, so I'd rather make a new post after than continue this one.
Chao
Monday, August 24, 2015
PfishBot:Autophishing: The Request: Part I
So we will jump back to messaging in a minute but first we need to go here:
https://m.facebook.com/findfriends/browser/
Where we can "find friends".
Now the JS here is really simple whip open console and we can do a test before we loop it
and now time to automate:
It may be best to use a for loop though but it works. You actually need a significant delay apparently facebook thinks the public is rather slow. So put as long as you need, a minute so that they never try to block you might be a good idea.
https://m.facebook.com/findfriends/browser/
Where we can "find friends".
Now the JS here is really simple whip open console and we can do a test before we loop it
Successful
And now we use the location.reload(), this will reset the suggestions:
1 2 3 4 5 6 7 8 9 | while(1){ document.querySelectorAll("button[type='submit']")[0].click(); setTimeout(func, 3000); function func(){ location.reload(); } } |
PfishBot:Auto Phishing: Messaging: Part I
Phishing is the process of creating fake IDs and making them appear real. I decided to automate the whole process from replying to messages to adding "friends".
The errors happened because of button ID change. Now we can text the click again, once we have entered text so as to fake the button(we will get to doing this automatically shortly):
First thing to do is set up the messaging system as this is doubtless to be the most difficult part.
First we find a weakpoint in the site to launch from, in the case of Facebook the page with the most functionality and least html to scan and possibly parse is:
Now I should mention that in order to create a fake account you will probably need a phone number, and getting past this is just not worth it as free applications such as text+ work just fine. Or use a payphone. I don't care.
Great now finding the message box name is easy:
"composerInput"
however the button for send is a bit more dynamic, it changes each time and there is a convoluted js and php script which hides it unless text was dynamically entered". Two ways past, JS or .Net.
JS
So the JS code is real simple:
Inspect the text box. Lets say for our example it is running under the ID of "u_0_5":
So our code is:
1 2 3 4 5 6 7 8 | var content = document.body.textContent || document.body.innerText; var hasText = content.indexOf("Way to go")!==-1; if(hasText){ setTimeout(function(){ document.getElementById('composerInput').value="Second Check"; document.getElementById('u_3p_5').click(); },5000); } But that really is not too useful because we have not been able to send it free of user interaction, due to that messy script(or set of scripts) we have left to tackle.
|
Sunday, August 9, 2015
Check site for User names
Well we all might want to programatically check a site for user names, quick demo post here, a kind I have not done in a while:
So for all you script kiddies out there here is what we end with:
So for all you script kiddies out there here is what we end with:
window.location = 'http://www.facebook.com' checkers(); function checkers() { var user = ''; var text = ''; var possible = 'abcdefghijklmnopqrstuvwxyz'; for (var i = 0; i < 6; i++) text += possible.charAt(Math.floor(Math.random() * possible.length)); document.forms[0].elements[1].value = text + '@gmail.com'; document.forms[0].elements[2].value = 'password'; var pablo = document.forms[0].elements[3]; pablo.click(); if (document.all('content').innerHTML.indexOf('Please try again') >= 0) { user = user.concat(text + '@gmail.com') checkers(); } } str.indexOf('Yes') >= 0
Now to run it:
A moder browser is all you really need. This post is really just a mod of the Bane JS Cracker I posted a while ago. Anyway just mess with the form elements depending on the site. Then you just need to save and parse string user however you choose. One could just C+V from a alert() window, and just change the infinite loop of this code to stop after a certain amount. Whatever your heart desires.
Quick old Digital Steg Pt 1
Finished the book so back to blogging again, heres a quick post:
To begin with we can just edit the straight up pixels, not unlike this:
To begin with we can just edit the straight up pixels, not unlike this:
size(200, 200); loadPixels(); for (int i = 0; i < pixels.length; i++) { float r= random(255); color c = color(r); pixels[i] = c; } updatePixels();
We just need to add an algorithm which encodes useful information, perhaps with less data(this image contains 250,000 bits. It might be best if we modify the pixels of an image, for better disguise than an old cctv when the lines are down. Here I'll whip up a quick example to get those started who are here for the first time:
PImage webImg; void setup(){ size(500, 500); String url = "https://processing.org/img/processing-web.png"; // Load image from a web server webImg = loadImage(url, "png"); } void draw(){ image(webImg, 0, 0); loadPixels(); for (int i = 0; i < 25000; i++) { float rand = random(255); color c = color(rand); pixels[i] = c; } updatePixels(); }
Of Course creating:The best way to disguise our messages are clever manipulations of the alpha levels, but lets keep it in "acceptable areas" near the edges of lines, so we will first mess with random alphas for demonstration, then create a "smart" program to hide our messages even more effectively, and then we will make the encoder/decoder.Okay, so just a random dash of message, or no particular meaning yet:See? Very sloppy. It is rather obvious those 4 dots caused by:PImage webImg; void setup(){ size(500, 500); String url = "https://processing.org/img/processing-web.png"; // Load image from a web server webImg = loadImage(url, "png"); } void draw(){ image(webImg, 0, 0); loadPixels(); for (int a = 0; a < 25; a++) { float i=random(pixels.length); float rand = random(255); color c = color(rand); pixels[(int)i] = c; } updatePixels(); }So we must use line detection and start to make our message meaningful. Let us start with the latter method and make a simple coding schema:CODING SCHEMA HERE
Now in addition we can also make messages through the combination of images which are meant to be deciphered by a human reader.The good old syllipsis program will also work just adding a contextualizer i.e. : "userenteredfilename"+".jpg" based on user input, but lets import the Syllipsis.jar code to speed things up, why code that which you yourself have already written?:
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 | import processing.core.*; import processing.data.*; import processing.opengl.*; import javax.swing.JFileChooser; import java.applet.*; import java.awt.Dimension; import java.awt.Frame; import java.awt.event.MouseEvent; import java.awt.event.KeyEvent; import java.awt.event.FocusEvent; import java.awt.Image; import java.io.*; import java.net.*; import java.text.*; import java.util.*; import java.util.zip.*; import java.util.regex.*; public class htmlsaver extends PApplet { String realtime; String file; String savers; boolean btn= false; String lastInput = new String(); String currentInput = new String(); public void setup() { background(204); size(800, 600); smooth(); textAlign(CENTER); } public void draw() { if (btn == true) { fill(255); } else { noFill(); } rect(20, 60, 75, 75); ellipse(60,90,50,50); fill(0); text("Thanks for Using Syllipsi By Daniel McCormack",width/2,60); text(lastInput, width/2, height/2); fill(255, 255, 255); text(currentInput, width/2, height*.75f); } public void mousePressed(){ if (btn){ exit(); } } public void keyPressed() { if(key == ENTER) { lastInput = currentInput = currentInput + key; currentInput = ""; lastInput="http://"+lastInput; JFileChooser chooser = new JFileChooser(); int returnVal = chooser.showOpenDialog(null); { println("Saving <HTML> to " + chooser.getSelectedFile().getName()); file = chooser.getSelectedFile().getName(); String currline[] = loadStrings(lastInput); for (int i = 0 ; i < currline.length; i++) { println(currline[i]); saveStrings(file,currline); } } } else if(key == BACKSPACE && currentInput.length() > 0) { currentInput = currentInput.substring(0, currentInput.length() - 1); } else { currentInput = currentInput + key; } } public void mouseMoved() { checkButtons(); //for our magical menu } public void mouseDragged() { checkButtons(); //again the gui menu check } public void checkButtons() { if (mouseX > 20 && mouseX < 95 && mouseY > 60 && mouseY < 135) { btn = true; //the final gui menu check } else { btn=false; } } static public void main(String[] passedArgs) { String[] appletArgs = new String[] { "--full-screen", "--bgcolor=#666666", "--stop-color=#cccccc", "htmlsaver" }; if (passedArgs != null) { PApplet.main(concat(appletArgs, passedArgs)); } else { PApplet.main(appletArgs); } } } |
And we only need the new JFileChooser() at the end to save our new "image chain".and lets focus on this region:
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 | public void keyPressed() { if(key == ENTER) { lastInput = currentInput = currentInput + key; currentInput = ""; lastInput=lastInput+".jpg";//contextualizer } else if(key == BACKSPACE && currentInput.length() > 0) { currentInput = currentInput.substring(0, currentInput.length() - 1); } else { currentInput = currentInput + key; //input update } } |
Let's fix this up with a little bit of reorganizing. We dump the menu chooser in the exit area. The "[ENTER] adds the picture.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 | import processing.core.*; import processing.data.*; import processing.opengl.*; import javax.swing.JFileChooser; import java.applet.*; import java.awt.Dimension; import java.awt.Frame; import java.awt.event.MouseEvent; import java.awt.event.KeyEvent; import java.awt.event.FocusEvent; import java.awt.Image; import java.io.*; import java.net.*; import java.text.*; import java.util.*; import java.util.zip.*; import java.util.regex.*; public class htmlsaver extends PApplet { PImage img; String realtime; String file; String savers; boolean btn= false; String lastInput = new String(); String currentInput = new String(); public void setup() { background(204); size(800, 600); smooth(); textAlign(CENTER); } public void draw() { if (btn == true) { fill(255); } else { noFill(); } rect(20, 60, 75, 75); ellipse(60,90,50,50); fill(0); text("Thanks for Using pixtitch By XOS",width/2,60); text(lastInput, width/2, height/2); fill(255, 255, 255); text(currentInput, width/2, height*.75f); String currline[] = loadStrings(lastInput); for (int i = 0 ; i < currline.length; i++) { println(currline[i]); saveStrings(file,currline); } } else if(key == BACKSPACE && currentInput.length() > 0) { currentInput = currentInput.substring(0, currentInput.length() - 1); } else { currentInput = currentInput + key; //input update } } } public void mousePressed(){ if (btn){ JFileChooser chooser = new JFileChooser(); //prompt a save if the "game" is over int returnVal = chooser.showOpenDialog(null); { println("Saving pixtitch to " + chooser.getSelectedFile().getName()); file = chooser.getSelectedFile().getName(); } } } public void keyPressed() { if(key == ENTER) { lastInput = currentInput = currentInput + key; currentInput = ""; lastInput=lastInput+".jpg";//contextualizer img = loadImage(lastInput); image(img, 0, 0); } } public void mouseMoved() { checkButtons(); //for our magical menu } public void mouseDragged() { checkButtons(); //again the gui menu check } public void checkButtons() { if (mouseX > 20 && mouseX < 95 && mouseY > 60 && mouseY < 135) { btn = true; //the final gui menu check } else { btn=false; } } static public void main(String[] passedArgs) { String[] appletArgs = new String[] { "--full-screen", "--bgcolor=#666666", "--stop-color=#cccccc", "htmlsaver" }; if (passedArgs != null) { PApplet.main(concat(appletArgs, passedArgs)); } else { PApplet.main(appletArgs); } } } |
And now focus on this:
1 2 3 4 5 6 7 8 9 10 11 12 13 | public void keyPressed() { if(key == ENTER) { lastInput = currentInput = currentInput + key; currentInput = ""; lastInput=lastInput+".jpg";//contextualizer img = loadImage(lastInput); int x=img.width int a=a+25 image(img, a, 0,25,25); } } |
And now to wrap things up:
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 | import processing.core.*; import processing.data.*; import processing.opengl.*; import javax.swing.JFileChooser; import java.applet.*; import java.awt.Dimension; import java.awt.Frame; import java.awt.event.MouseEvent; import java.awt.event.KeyEvent; import java.awt.event.FocusEvent; import java.awt.Image; import java.io.*; import java.net.*; import java.text.*; import java.util.*; import java.util.zip.*; import java.util.regex.*; public class htmlsaver extends PApplet { PImage img; String realtime; String file; String savers; boolean btn= false; String lastInput = new String(); String currentInput = new String(); public void setup() { int a=0; background(204); size(800, 600); smooth(); textAlign(CENTER); } public void draw() { if (btn == true) { fill(255); } else { noFill(); } rect(20, 60, 75, 75); ellipse(60,90,50,50); fill(0); text("Thanks for Using pixtitch By XOS",width/2,60); text(lastInput, width/2, height/2); fill(255, 255, 255); text(currentInput, width/2, height*.75f); String currline[] = loadStrings(lastInput); for (int i = 0 ; i < currline.length; i++) { println(currline[i]); saveStrings(file,currline); } } else if(key == BACKSPACE && currentInput.length() > 0) { currentInput = currentInput.substring(0, currentInput.length() - 1); } else { currentInput = currentInput + key; //input update } } } public void mousePressed(){ if (btn){ JFileChooser chooser = new JFileChooser(); //prompt a save if the "game" is over int returnVal = chooser.showOpenDialog(null); { println("Saving pixtitch to " + chooser.getSelectedFile().getName()); file = chooser.getSelectedFile().getName(); } } } public void keyPressed() { if(key == ENTER) { lastInput = currentInput = currentInput + key; currentInput = ""; lastInput=lastInput+".jpg";//contextualizer img = loadImage(lastInput); int x=img.width int a=a+25 image(img, a, 0,25,25); } } public void mouseMoved() { checkButtons(); //for our magical menu } public void mouseDragged() { checkButtons(); //again the gui menu check } public void checkButtons() { if (mouseX > 20 && mouseX < 95 && mouseY > 60 && mouseY < 135) { btn = true; //the final gui menu check } else { btn=false; } } static public void main(String[] passedArgs) { String[] appletArgs = new String[] { "--full-screen", "--bgcolor=#666666", "--stop-color=#cccccc", "htmlsaver" }; if (passedArgs != null) { PApplet.main(concat(appletArgs, passedArgs)); } else { PApplet.main(appletArgs); } } } |
Wednesday, August 5, 2015
Xantivirus
Screenshot of antivirus/antimalware software I whipped up, works quite well:
Just time to create own icons and debug a few detector issues.
Just time to create own icons and debug a few detector issues.
Tuesday, July 21, 2015
Monday, July 13, 2015
SCUBA part i
In order to film the ROV's I whipped up a quick "air backpack" for a little extra cinematic time beneath the waves. Now I recommend attaching balloons at the ends of the pipes as these contract as they lose air and help to maintain the pressure. Note that below certain depths it will become difficult and then impossible to breathe. Additoinally after certain lengths of time it will become impossible as the pressure becomes to low and you run out of air.
The breathing technique is a breath in through the mouthpeice and a breath(subsequent) out through the nostrils( the equipped mask has a fan, it is a Dolfino as is the snorkel.
Surgical tubing, or latex hose as hardware departments( such as Lowes) refer to them as was used for the tank to regulator atachment. A ribbed connector connects it, it you do end up doing this you are liable but I will recommend ensurig the tube is well pushed on to the 5/16 inch brass barb fitting which is hammered into a drilled 1/2 inch pvc(referring to pipe) end cap. Pressurizing can be done with a tire valve. I used a similiar system in the post on the tornado generator and it can be seen pressurizing bottle as an explosive vessel for tornado disruption.
I will be doing a few more post on Scuba equipment as I make it for use. Safe diving.
Wednesday, July 8, 2015
New ROV Company Site
I just launched the new company site at www.rovx.xyz.com where we manufacture ROV and parts. If you are interested in any of the products or would like to try to reduce the price, use the contact form there to email me. The webstore is accessible at http://www.rovx.xyz/#!blank/agnua.
Please Check it out and forward the site to interested colleagues and or friends.
Wednesday, June 17, 2015
Audio Data from Genetic Code[For An Actual Purpose]
Right, so as I mentioned in the post on the Basic Audio Analysis tool I mentioned Hamming distances. I wrote the Audio Analysis tool because it could also be used with the VD genetics tools that I have been working on and describing at the linked location. Now the method I demonstrated is also useful for returning the Ham function back to the top of the program so to speak(so that it can be analyzed or cross analyzed) and to use the other functions as well, for instance the Ham of the Distance function of each waveform would be useful for a more accurate comparison of the two as it equalizes them using abs val.
Recall that the data is in the format of:
And now we import the data:
Recall that the data is in the format of:
Unfortunately this post is more of a how to so far but, what the hell I guess they all are. Anyway now for how to do this with genetic data(still a How To, I suppose):
Just write a good old formula( probably 20 or 4 depending on whether you are messing with Aminos or Nucleics. Lets do nucleics for simplicity:
rtf.Text= "a c t g g t c a c g t a g c a t" 'you can use an array or manually add in the \n via replace(all,any,any +\n) 'now I mention the above comment because if using the aminos the vals will be over double digits and thus 'the lines must be used or commas or colons or # or % or &(you get the idea hopefully) rtf.Text=Replace(rtf.Text,"a","1") rtf.Text=Replace(rtf.Text,"g","2") rtf.Text=Replace(rtf.Text,"c","3") rtf.Text=Replace(rtf.Text,"t","4") 'note that base pairs add to 5, just an easy checking method for later more complex operations which are profitable financially and thus will not be blogged about
Now these are numbers so just run the audacity operation on them export as a .wav file, and then run through the program. There you go, audio from genetic data and you can calculate Hamm(kinda) and perform other useful operations on the data. Cheers!
UniPirate: Downloading and Sorting Big Data(Protein Database)
I started to download more of the protein codes, but rather than make a regex script to mess with them after(delete HTML, JS, and bank data) I decided to just use regex while the file is in the prog RAM(ha) and delete it then using Replace(string,"X","Y").
which appears when the p# or http://www.(baseurl)/P99314 does not exist in the data base, it has a distinct error code in the html though note <title>Error</title> so, a
if(WebBrowser.DocumentText.Contains("Error")=True){
main()
}
is a simple way to just jump over empty slots. The database is so huge that we really don't need to systematically go through, in fact the empty slots are not all at large numbers they appear to vary throughout, and a shotgun blast(i.e. bad aim, through a random number generator) is the easisest method as it contains the fairest distribution from multiple organism types. See downloading the .fasta provides this info along with some other information about the string:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN">
<HTML><HEAD>
<META content="text/html; charset=windows-1252" http-equiv=Content-Type></HEAD>
<BODY><PRE>>sp|P42889|COL_MYOCO Colipase OS=Myocastor coypus GN=CLPS PE=1 SV=1
MEKVLALVLLTLAVAYAAPDPRGLIINLDNGELCLNSAQCKSQCCQHDSPLGLARCADKA
RENSGCSPQTIYGIYYLCPCERGLTCDGDKSIIGAITNTNYGICQDPQSKK
</PRE></BODY></HTML>
So basically we have to remove all this nonsense(the Html to begin with) which is simple enough.
rtf.Text = Replace(rtf.Text, "bothersometext", "")
so on and so forth for whatever might be in the way. Then we need to organize them based on animal, super easy, the likely hood of the genetic code spelling MOUSE, is pretty low there are some 20 amino acids so that's .05^5 or about 0.00000003125,and since probabilities don't really matter since it doesn't limit it from happening, just take my word that it is unlikely(the strings are small too so each time is a new instance so it is really unlikely). Now you can avoid this problem all together if you set the Regex(this is default in vb,C# etc) so that capitalization is ignored as the majority of the OS names(organism) are spelt like:
Mouse
Human
and ussually latin names are included so you can really cover your bases if you like or truly guarantee by using a different alphabet and by that I mean numbers(the organism identifier number string).
In order to sort the files:
Now for performance, it may be best to take each findstr instance and use it as its own separate program or process so as to maximize distribution over the multiple cores of the cpu. It truly depends on the list of OS's and the size of the data.
I will be writing up a renaming program at some point so that:
|P42889|COL_MYOCO Colipase OS=Myocastor coypus GN=CLPS PE=1 SV=1
MEKVLALVLLTLAVAYAAPDPRGLIINLDNGELCLNSAQCKSQCCQHDSPLGLARCADKA
RENSGCSPQTIYGIYYLCPCERGLTCDGDKSIIGAITNTNYGICQDPQSKK
is saved as Colipase in C:\Myocastor_coypus ( the latter of the two operations is already performed by doghunter.bat which is the program shown above in the Gvim window.
Oh, and to answer questions before they present themselves. Yes, the operation above is a copy operation and not a cut. I do this so as to preserve originals of the files to have a fall back in case something goes terrible wrong <program|original|end> is better than <download|program|original> and then an<program|original|end>. Just for safety, good practice when working with a database the size of all the proteins ever sequenced and publicly stored.
MEKVLALVLLTLAVAYAAPDPRGLIINLDNGELCLNSAQCKSQCCQHDSPLGLARCADKA
RENSGCSPQTIYGIYYLCPCERGLTCDGDKSIIGAITNTNYGICQDPQSKK
is saved as Colipase in C:\Myocastor_coypus ( the latter of the two operations is already performed by doghunter.bat which is the program shown above in the Gvim window.
Oh, and to answer questions before they present themselves. Yes, the operation above is a copy operation and not a cut. I do this so as to preserve originals of the files to have a fall back in case something goes terrible wrong <program|original|end> is better than <download|program|original> and then an<program|original|end>. Just for safety, good practice when working with a database the size of all the proteins ever sequenced and publicly stored.
Basic Audio Forensic Analysis Program
During a talent show at school I tried my hand at rapping and during a speed rap section the camera sampling rate blended words and an innocent and rather clever phrase was picked up as something entirely different(Yes I rapped).
Having another recording from an alternate source I set out to prove that there was a significant difference between the two recordings the reason however I would leave up to them, though in a coming post I think I'll make a digital forensics package(for files that is). Anywho lets get to it:
So the basic idea was to load the audio, split db and pitch into to sections(which is why I switched to the MS Studio C# collection as it has this lib function built in. Simple from here, we just break this down into text and output to two textboxes:
Sure, yeah, I could easily have used two strings to hold the data but the text box will come in handy later and it is useful for later running through the data and selecting rows. So we want to calculate the Hamming Distance so, made a File>HAM, option:
Having another recording from an alternate source I set out to prove that there was a significant difference between the two recordings the reason however I would leave up to them, though in a coming post I think I'll make a digital forensics package(for files that is). Anywho lets get to it:
using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; namespace AudioAnalysis { public partial class Form1 : Form { public Form1() { // reader2.Text = track0.Value.ToString(); InitializeComponent(); } private void openWaveToolStripMenuItem_Click(object sender, EventArgs e) { OpenFileDialog open = new OpenFileDialog(); open.Filter = "Wave File (*.wav)|*.wav;"; if (open.ShowDialog() != DialogResult.OK) return; waveViewer1.SamplesPerPixel = 450; waveViewer1.WaveStream = new NAudio.Wave.WaveFileReader(open.FileName); chart1.Series.Add("wave"); chart1.Series["wave"].ChartType = System.Windows.Forms.DataVisualization.Charting.SeriesChartType.FastLine; chart1.Series["wave"].ChartArea = "ChartArea1"; NAudio.Wave.WaveChannel32 wave = new NAudio.Wave.WaveChannel32(new NAudio.Wave.WaveFileReader(open.FileName)); byte[] buffer = new byte[track.Value]; int read = 0; while (wave.Position < track.Value) { read = wave.Read(buffer, 0, track.Value); for (int i = track0.Value; i < read / 4; i++) { chart1.Series["wave"].Points.Add(BitConverter.ToSingle(buffer, i * 4)); string stringy = (10*BitConverter.ToSingle(buffer, i * 4)).ToString(); outsalot.AppendText(stringy + "\n"); bar.Value = i; if (bar.Value == bar.Maximum-1) { bar.Value = 0; } } } } private void readout_TextChanged(object sender, EventArgs e) { track.Value = Int32.Parse(readout.Text); } private void track_Scroll(object sender, EventArgs e) { readout.Text = track.Value.ToString(); bar.Maximum = track.Value/4; } private void chart1_Click(object sender, EventArgs e) { } private void logToolStripMenuItem_Click(object sender, EventArgs e) { } private void track0_Scroll(object sender, EventArgs e) { reader2.Text = track0.Value.ToString(); } private void reader2_TextChanged(object sender, EventArgs e) { track0.Value = Int32.Parse(reader2.Text); } private void hAMToolStripMenuItem_Click(object sender, EventArgs e) { for (int vxl = 0; vxl < outsalot.Lines.Length-5; vxl = vxl + 1) { string hamm = (float.Parse(outsalot.Lines[vxl]) - float.Parse(outsytwo.Lines[vxl])).ToString(); hamming.Text = hamming.Text + hamm+"\n"; bar.Maximum = outsalot.Lines.Length - 5; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } } private void move_Click(object sender, EventArgs e) { outsytwo.Text = outsalot.Text; outsalot.ResetText(); chart1.Series.Clear(); } private void diracΔToolStripMenuItem_Click(object sender, EventArgs e) { for (int vxl = 0; vxl < outsalot.Lines.Length ; vxl = vxl + 1) { string hamm = ((float.Parse(outsalot.Lines[vxl]) - Int32.Parse(outsytwo.Lines[vxl]))/Math.Abs((float.Parse(outsalot.Lines[vxl]) - Int32.Parse(outsytwo.Lines[vxl])))).ToString(); hamming.Text = hamming.Text + hamm + "\n"; bar.Maximum = outsalot.Lines.Length; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } } private void differenceToolStripMenuItem_Click(object sender, EventArgs e) { for (int vxl = 0; vxl < outsalot.Lines.Length-1; vxl = vxl + 1) { string one = ((float.Parse(outsalot.Lines[vxl]) - float.Parse(outsalot.Lines[vxl+1]))) .ToString(); hamming.Text = hamming.Text + one + "\n"; bar.Maximum = outsalot.Lines.Length; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } outsalot.Text=hamming.Text; hamming.Text=""; for (int vxl = 0; vxl < outsalot.Lines.Length-1; vxl = vxl + 1) { string two = ((float.Parse(outsytwo.Lines[vxl]) - float.Parse(outsytwo.Lines[vxl + 1]))).ToString(); hamming.Text = hamming.Text + two+ "\n"; bar.Maximum = outsytwo.Lines.Length; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } outsytwo.Text=hamming.Text; hamming.Text = ""; } private void hamming_TextChanged(object sender, EventArgs e) { hamming.Text = hamming.Text.Replace("NaN", "0"); } } }
So the basic idea was to load the audio, split db and pitch into to sections(which is why I switched to the MS Studio C# collection as it has this lib function built in. Simple from here, we just break this down into text and output to two textboxes:
Sure, yeah, I could easily have used two strings to hold the data but the text box will come in handy later and it is useful for later running through the data and selecting rows. So we want to calculate the Hamming Distance so, made a File>HAM, option:
private void hAMToolStripMenuItem_Click(object sender, EventArgs e) { for (int vxl = 0; vxl < outsalot.Lines.Length-5; vxl = vxl + 1) { string hamm = (float.Parse(outsalot.Lines[vxl]) - float.Parse(outsytwo.Lines[vxl])).ToString(); hamming.Text = hamming.Text + hamm+"\n"; bar.Maximum = outsalot.Lines.Length - 5; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } }
which really just subtracts the two waveforms. How? well you need to open the two separate waveforms which is where the empty white textbox and the [Move] <button> come into play. Press the move button, open the second wave form and calculate the HAM.(Again File>HAM though hopefully you recall).
Also I should point out, I did not take the time to fix the scrolling bars at the top(these select how much of the WaveForm(.wav) files you wish to analyse. So what you need to do before even opening the first WAV is to move these around until numbers appear in the text box(I recommend 0 left and 16384 right, and just cut the audio so that they are in the same place on something like audacity). Now about what I just said about cutting them to the same place. You don't really need to. To check for changes that are not Amplitudinal(new word) then this is just a quick mathematical operation on the Hammed functions(not the difference of the WAV's). If the difference between each can be attributed to a multiplicative factor ie our strings are:
363693639
121231213
Then we can say that the only difference is caused by an audio gain function, whose multiplier is 3.
The DiracΔ function starts to hit on that:
private void diracΔToolStripMenuItem_Click(object sender, EventArgs e) { for (int vxl = 0; vxl < outsalot.Lines.Length ; vxl = vxl + 1) { string hamm = ((float.Parse(outsalot.Lines[vxl]) - Int32.Parse(outsytwo.Lines[vxl]))/Math.Abs((float.Parse(outsalot.Lines[vxl]) - Int32.Parse(outsytwo.Lines[vxl])))).ToString(); hamming.Text = hamming.Text + hamm + "\n"; bar.Maximum = outsalot.Lines.Length; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } }It takes the vals, subtracts and divides by the absolute in order to work with multiplicatives. Does this have anything to do with DiracΔ functions. Not really I was just playing on the fact that the entire issue(dispute) is probably due to the lower sampling rate of the microphones used by the aggressors.Now the difference function( FILE>Difference), wait hold up, here is a pic of the menu for refs:Right, and here is the code for Difference:private void differenceToolStripMenuItem_Click(object sender, EventArgs e) { for (int vxl = 0; vxl < outsalot.Lines.Length-1; vxl = vxl + 1) { string one = ((float.Parse(outsalot.Lines[vxl]) - float.Parse(outsalot.Lines[vxl+1]))) .ToString(); hamming.Text = hamming.Text + one + "\n"; bar.Maximum = outsalot.Lines.Length; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } outsalot.Text=hamming.Text; hamming.Text=""; for (int vxl = 0; vxl < outsalot.Lines.Length-1; vxl = vxl + 1) { string two = ((float.Parse(outsytwo.Lines[vxl]) - float.Parse(outsytwo.Lines[vxl + 1]))).ToString(); hamming.Text = hamming.Text + two+ "\n"; bar.Maximum = outsytwo.Lines.Length; bar.Value = vxl; if (bar.Value == outsalot.Lines.Length - 10) { bar.Value = 0; } } outsytwo.Text=hamming.Text; hamming.Text = ""; }Difference differs(ha) from the other functions in that it works or acts upon only one waveform(at a time and we could run Difference on the Hamming distance function of the two waveforms). It subtracts element [x] from element [x+1] all the way to [(max(x)-1)-(max(x)-2)], the reason being that the differences between successive elements should be the same in each waveform if they have not been tampered with and there is not too many confounding variables from outside sources(audience etc).Now I ussually do not write up the code for the visuals but in this case it is useful as I did utilize a split container to hold everything. You can delete the db graph(top one) as it does nothing for us(volume is not entirely useful when we are talking about vocal modification, although we can sort of use it to mess with the difference functions we talked about earlier as I described them in terms of db and not pitch though they are currently programmed to work on pitch. To work on db you need to convert arrays to txt \n format).namespace AudioAnalysis { partial class Form1 { /// <summary> /// Required designer variable. /// </summary> private System.ComponentModel.IContainer components = null; /// <summary> /// Clean up any resources being used. /// </summary> /// <param name="disposing">true if managed resources should be disposed; otherwise, false.</param> protected override void Dispose(bool disposing) { if (disposing && (components != null)) { components.Dispose(); } base.Dispose(disposing); } #region Windows Form Designer generated code /// <summary> /// Required method for Designer support - do not modify /// the contents of this method with the code editor. /// </summary> private void InitializeComponent() { this.components = new System.ComponentModel.Container(); System.Windows.Forms.DataVisualization.Charting.ChartArea chartArea1 = new System.Windows.Forms.DataVisualization.Charting.ChartArea(); this.menuStrip1 = new System.Windows.Forms.MenuStrip(); this.fileToolStripMenuItem = new System.Windows.Forms.ToolStripMenuItem(); this.openWaveToolStripMenuItem = new System.Windows.Forms.ToolStripMenuItem(); this.hAMToolStripMenuItem = new System.Windows.Forms.ToolStripMenuItem(); this.diracΔToolStripMenuItem = new System.Windows.Forms.ToolStripMenuItem(); this.differenceToolStripMenuItem = new System.Windows.Forms.ToolStripMenuItem(); this.logToolStripMenuItem = new System.Windows.Forms.ToolStripMenuItem(); this.splitContainer1 = new System.Windows.Forms.SplitContainer(); this.move = new System.Windows.Forms.Button(); this.outsalot = new System.Windows.Forms.RichTextBox(); this.waveViewer1 = new NAudio.Gui.WaveViewer(); this.hamming = new System.Windows.Forms.RichTextBox(); this.outsytwo = new System.Windows.Forms.RichTextBox(); this.chart1 = new System.Windows.Forms.DataVisualization.Charting.Chart(); this.bindingSource1 = new System.Windows.Forms.BindingSource(this.components); this.track = new System.Windows.Forms.TrackBar(); this.readout = new System.Windows.Forms.TextBox(); this.bar = new System.Windows.Forms.ProgressBar(); this.track0 = new System.Windows.Forms.TrackBar(); this.reader2 = new System.Windows.Forms.TextBox(); this.menuStrip1.SuspendLayout(); ((System.ComponentModel.ISupportInitialize)(this.splitContainer1)).BeginInit(); this.splitContainer1.Panel1.SuspendLayout(); this.splitContainer1.Panel2.SuspendLayout(); this.splitContainer1.SuspendLayout(); ((System.ComponentModel.ISupportInitialize)(this.chart1)).BeginInit(); ((System.ComponentModel.ISupportInitialize)(this.bindingSource1)).BeginInit(); ((System.ComponentModel.ISupportInitialize)(this.track)).BeginInit(); ((System.ComponentModel.ISupportInitialize)(this.track0)).BeginInit(); this.SuspendLayout(); // // menuStrip1 // this.menuStrip1.BackColor = System.Drawing.Color.WhiteSmoke; this.menuStrip1.Items.AddRange(new System.Windows.Forms.ToolStripItem[] { this.fileToolStripMenuItem, this.logToolStripMenuItem}); this.menuStrip1.Location = new System.Drawing.Point(0, 0); this.menuStrip1.Name = "menuStrip1"; this.menuStrip1.Size = new System.Drawing.Size(1091, 24); this.menuStrip1.TabIndex = 0; this.menuStrip1.Text = "menuStrip1"; // // fileToolStripMenuItem // this.fileToolStripMenuItem.DropDownItems.AddRange(new System.Windows.Forms.ToolStripItem[] { this.openWaveToolStripMenuItem, this.hAMToolStripMenuItem, this.diracΔToolStripMenuItem, this.differenceToolStripMenuItem}); this.fileToolStripMenuItem.Name = "fileToolStripMenuItem"; this.fileToolStripMenuItem.Size = new System.Drawing.Size(37, 20); this.fileToolStripMenuItem.Text = "File"; // // openWaveToolStripMenuItem // this.openWaveToolStripMenuItem.Name = "openWaveToolStripMenuItem"; this.openWaveToolStripMenuItem.Size = new System.Drawing.Size(135, 22); this.openWaveToolStripMenuItem.Text = "Open Wave"; this.openWaveToolStripMenuItem.Click += new System.EventHandler(this.openWaveToolStripMenuItem_Click); // // hAMToolStripMenuItem // this.hAMToolStripMenuItem.Name = "hAMToolStripMenuItem"; this.hAMToolStripMenuItem.Size = new System.Drawing.Size(135, 22); this.hAMToolStripMenuItem.Text = "HAM"; this.hAMToolStripMenuItem.Click += new System.EventHandler(this.hAMToolStripMenuItem_Click); // // diracΔToolStripMenuItem // this.diracΔToolStripMenuItem.Name = "diracΔToolStripMenuItem"; this.diracΔToolStripMenuItem.Size = new System.Drawing.Size(135, 22); this.diracΔToolStripMenuItem.Text = "DiracΔ"; this.diracΔToolStripMenuItem.Click += new System.EventHandler(this.diracΔToolStripMenuItem_Click); // // differenceToolStripMenuItem // this.differenceToolStripMenuItem.Name = "differenceToolStripMenuItem"; this.differenceToolStripMenuItem.Size = new System.Drawing.Size(135, 22); this.differenceToolStripMenuItem.Text = "Difference"; this.differenceToolStripMenuItem.Click += new System.EventHandler(this.differenceToolStripMenuItem_Click); // // logToolStripMenuItem // this.logToolStripMenuItem.Name = "logToolStripMenuItem"; this.logToolStripMenuItem.Size = new System.Drawing.Size(39, 20); this.logToolStripMenuItem.Text = "Log"; this.logToolStripMenuItem.Click += new System.EventHandler(this.logToolStripMenuItem_Click); // // splitContainer1 // this.splitContainer1.Dock = System.Windows.Forms.DockStyle.Fill; this.splitContainer1.Location = new System.Drawing.Point(0, 24); this.splitContainer1.Name = "splitContainer1"; this.splitContainer1.Orientation = System.Windows.Forms.Orientation.Horizontal; // // splitContainer1.Panel1 // this.splitContainer1.Panel1.Controls.Add(this.move); this.splitContainer1.Panel1.Controls.Add(this.outsalot); this.splitContainer1.Panel1.Controls.Add(this.waveViewer1); // // splitContainer1.Panel2 // this.splitContainer1.Panel2.Controls.Add(this.hamming); this.splitContainer1.Panel2.Controls.Add(this.outsytwo); this.splitContainer1.Panel2.Controls.Add(this.chart1); this.splitContainer1.Size = new System.Drawing.Size(1091, 461); this.splitContainer1.SplitterDistance = 227; this.splitContainer1.TabIndex = 1; // // move // this.move.Location = new System.Drawing.Point(926, 180); this.move.Name = "move"; this.move.Size = new System.Drawing.Size(153, 23); this.move.TabIndex = 2; this.move.Text = "Move"; this.move.UseVisualStyleBackColor = true; this.move.Click += new System.EventHandler(this.move_Click); // // outsalot // this.outsalot.Location = new System.Drawing.Point(926, 3); this.outsalot.Name = "outsalot"; this.outsalot.Size = new System.Drawing.Size(153, 174); this.outsalot.TabIndex = 1; this.outsalot.Text = ""; // // waveViewer1 // this.waveViewer1.Location = new System.Drawing.Point(0, 6); this.waveViewer1.Name = "waveViewer1"; this.waveViewer1.SamplesPerPixel = 128; this.waveViewer1.Size = new System.Drawing.Size(920, 195); this.waveViewer1.StartPosition = ((long)(0)); this.waveViewer1.TabIndex = 0; this.waveViewer1.WaveStream = null; // // hamming // this.hamming.BackColor = System.Drawing.SystemColors.InactiveCaptionText; this.hamming.ForeColor = System.Drawing.SystemColors.Menu; this.hamming.Location = new System.Drawing.Point(788, 4); this.hamming.Name = "hamming"; this.hamming.Size = new System.Drawing.Size(132, 213); this.hamming.TabIndex = 2; this.hamming.Text = ""; this.hamming.TextChanged += new System.EventHandler(this.hamming_TextChanged); // // outsytwo // this.outsytwo.Location = new System.Drawing.Point(926, 4); this.outsytwo.Name = "outsytwo"; this.outsytwo.Size = new System.Drawing.Size(162, 213); this.outsytwo.TabIndex = 1; this.outsytwo.Text = ""; // // chart1 // chartArea1.Name = "ChartArea1"; this.chart1.ChartAreas.Add(chartArea1); this.chart1.Location = new System.Drawing.Point(0, 0); this.chart1.Name = "chart1"; this.chart1.Palette = System.Windows.Forms.DataVisualization.Charting.ChartColorPalette.EarthTones; this.chart1.Size = new System.Drawing.Size(782, 201); this.chart1.TabIndex = 0; this.chart1.Text = "chart1"; this.chart1.Click += new System.EventHandler(this.chart1_Click); // // track // this.track.Location = new System.Drawing.Point(519, 0); this.track.Maximum = 16384; this.track.Name = "track"; this.track.Size = new System.Drawing.Size(303, 45); this.track.TabIndex = 1; this.track.Value = 16384; this.track.Scroll += new System.EventHandler(this.track_Scroll); // // readout // this.readout.BackColor = System.Drawing.SystemColors.HotTrack; this.readout.ForeColor = System.Drawing.SystemColors.Menu; this.readout.Location = new System.Drawing.Point(464, 4); this.readout.Name = "readout"; this.readout.Size = new System.Drawing.Size(49, 20); this.readout.TabIndex = 2; this.readout.TextChanged += new System.EventHandler(this.readout_TextChanged); // // bar // this.bar.Location = new System.Drawing.Point(816, 0); this.bar.Name = "bar"; this.bar.Size = new System.Drawing.Size(272, 23); this.bar.TabIndex = 3; // // track0 // this.track0.BackColor = System.Drawing.SystemColors.Control; this.track0.Location = new System.Drawing.Point(82, -2); this.track0.Maximum = 16384; this.track0.Name = "track0"; this.track0.Size = new System.Drawing.Size(303, 45); this.track0.TabIndex = 4; this.track0.Scroll += new System.EventHandler(this.track0_Scroll); // // reader2 // this.reader2.BackColor = System.Drawing.Color.Maroon; this.reader2.ForeColor = System.Drawing.SystemColors.Menu; this.reader2.Location = new System.Drawing.Point(388, 4); this.reader2.Name = "reader2"; this.reader2.Size = new System.Drawing.Size(49, 20); this.reader2.TabIndex = 5; this.reader2.TextChanged += new System.EventHandler(this.reader2_TextChanged); // // Form1 // this.AutoScaleDimensions = new System.Drawing.SizeF(6F, 13F); this.AutoScaleMode = System.Windows.Forms.AutoScaleMode.Font; this.ClientSize = new System.Drawing.Size(1091, 485); this.Controls.Add(this.reader2); this.Controls.Add(this.track0); this.Controls.Add(this.bar); this.Controls.Add(this.readout); this.Controls.Add(this.track); this.Controls.Add(this.splitContainer1); this.Controls.Add(this.menuStrip1); this.MainMenuStrip = this.menuStrip1; this.Name = "Form1"; this.Text = "AudioAnalysis"; this.menuStrip1.ResumeLayout(false); this.menuStrip1.PerformLayout(); this.splitContainer1.Panel1.ResumeLayout(false); this.splitContainer1.Panel2.ResumeLayout(false); ((System.ComponentModel.ISupportInitialize)(this.splitContainer1)).EndInit(); this.splitContainer1.ResumeLayout(false); ((System.ComponentModel.ISupportInitialize)(this.chart1)).EndInit(); ((System.ComponentModel.ISupportInitialize)(this.bindingSource1)).EndInit(); ((System.ComponentModel.ISupportInitialize)(this.track)).EndInit(); ((System.ComponentModel.ISupportInitialize)(this.track0)).EndInit(); this.ResumeLayout(false); this.PerformLayout(); } #endregion private System.Windows.Forms.MenuStrip menuStrip1; private System.Windows.Forms.ToolStripMenuItem fileToolStripMenuItem; private System.Windows.Forms.ToolStripMenuItem openWaveToolStripMenuItem; private System.Windows.Forms.SplitContainer splitContainer1; private NAudio.Gui.WaveViewer waveViewer1; private System.Windows.Forms.DataVisualization.Charting.Chart chart1; private System.Windows.Forms.ToolStripMenuItem logToolStripMenuItem; private System.Windows.Forms.BindingSource bindingSource1; private System.Windows.Forms.TrackBar track; private System.Windows.Forms.TextBox readout; private System.Windows.Forms.RichTextBox outsalot; private System.Windows.Forms.ProgressBar bar; private System.Windows.Forms.RichTextBox outsytwo; private System.Windows.Forms.TrackBar track0; private System.Windows.Forms.TextBox reader2; private System.Windows.Forms.ToolStripMenuItem hAMToolStripMenuItem; private System.Windows.Forms.RichTextBox hamming; private System.Windows.Forms.Button move; private System.Windows.Forms.ToolStripMenuItem diracΔToolStripMenuItem; private System.Windows.Forms.ToolStripMenuItem differenceToolStripMenuItem; } }
Subscribe to:
Posts (Atom)





























